P43026

8200

14.52 kDa

18 kDa

Cartilage-Derived Morphogenetic Protein-1,Growth/Differentiation Factor-5,GDF-5, CDMP-1

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <14 ng/mL.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP-14 is a principal inhibitor of cartilage development and is predominantly expressed in long bone during human embryonic development. Recombinant human BMP-14 is a 27 kDa homodimeric protein consisting of two 120 amino acid polypeptide chains.

The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus.