Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine ,AF
Source: Cytokines  Catalog No. : PY2922 
Recombinant TGF beta 1 (Transforming growth factor beta 1), Swine ,AF (PY2922)
UniProt:P07200
Application:Cell culture,Elisa
Endotoxin level:<0.1 EU per 1 μg of the protein by the LAL method.
Source:Swine Cytokineshttp://www.abways.com/showproduct.asp?cid=PY2922
Data Sheet
  • UniProt
  • Gene ID
    397078
  • Calculated Molecular Weight
    13.7 kDa
  • SDS-PAGE Molecular Weight(under reducing condition)
    11-17 kDa
  • Alternative Names
    TGF-BETA-1, TGFB1
  • Activity
    Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL.
  • Storage
    Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei
  • Purification
    >98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag
    His-tag at the C-terminus
  • Expression Host
    Escherichia coli
  • Description
    Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
  • Formulation
    The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HC
Applications
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Application
    Cell culture,Elisa
  • Expression Sequence
    MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
  • SDS- PAGE analysis of recombinant swine TGF beta 1
Catalog No:PY2922
  • Size:5ug/20ug
  • Price:¥160/400
  • Delivery:3-4 days
Order Information:
You can contact authorized dealers to purchase Abways products and obtain support. You can also contact Abways China directly