Recombinant Annexin V, Human ,AF
Source: Cytokines  Catalog No. : PY2104 
Recombinant Annexin V, Human ,AF (PY2104)
UniProt:P08758
Application:Cell culture,Elisa
Endotoxin level:<0.1 EU per 1 μg of the protein by the LAL method.
Source:Human Cytokineshttp://www.abways.com/showproduct.asp?cid=PY2104
Data Sheet
  • UniProt
  • Gene ID
    308
  • Calculated Molecular Weight
    36.75 kDa
  • SDS-PAGE Molecular Weight(under reducing condition)
    37 kDa
  • Alternative Names
    ANXA5, ANX5, ENX2, HEL-S-7, PP4, RPRGL3
  • Activity
    Testing in process
  • Storage
    Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei
  • Purification
    >98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag
    His-tag at the C-terminus
  • Expression Host
    Escherichia coli
  • Description
    Annexin V is a cellular protein in the annexin group. In flow experiment, annexin V is commonly used to detect apoptotic cells by its ability to bind to phosphatidylserine, a marker of apoptosis when it is on the outer leaflet of the plasma membrane. Annexin V has been proposed to play a role in the inhibition of blood coagulation by competing for phosphatidylserine binding sites with prothrombin and also to inhibit the activity of phospholipase A1.
  • Formulation
    down/PY2104.pdf
  • Reconstitution
    The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Application
    Cell culture,Elisa
  • Expression Sequence
    MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETL
  • SDS- PAGE analysis of recombinant human Annexin V
Catalog No:PY2104
  • Size:5ug/20ug/100ug/500ug/1mg
  • Price:$85/210/630/1800/2800
  • Delivery:3-4 days
Order Information:
You can contact authorized dealers to purchase Abways products and obtain support. You can also contact Abways China directly