P09529

3625

13.75 kDa

17 kDa

Activin Beta B, INHBB; inhibin beta B chain

Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <0.7 ng/mL. The specific activity of recombinant human Activin B is > 1.5 x 106 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-tag at the C-terminus

Escherichia coli

Activins and inhibins, members of the TGF-beta superfamily, are disulfide-linked dimeric proteins that were originally purified from gonadal fluids as proteins that stimulated or inhibited, respectively, pituitary follicle stimulating hormone (FSH) release. Activin is strongly expressed in wounded skin, and overexpression of activin in epidermis of transgenic mice improves wound healing and enhances scar formation. Activin also regulates the morphogenesis of branching organs such as the prostate, lung, and kidney. There is also evidence showed that lack of activin during development results in neural developmental defects.

down/PY2102.pdf

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.